SCOPe 2.05: Domain d3ojvd2: 3ojv D:250-359

Lineage for d3ojvd2 (3ojv D:250-359)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (26 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
Domain d3ojvd2: 3ojv D:250-359 [214404]
Other proteins in same PDB: d3ojva_, d3ojvb_
automated match to d1djsa2

Details for d3ojvd2

PDB Entry: 3ojv (more details), 2.6 Å

PDB Description: crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop

PDB Compounds: (D:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3ojvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojvd2 b.1.1.0 (D:250-359) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvq
ilktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

SCOPe Domain Coordinates for d3ojvd2:

Click to download the PDB-style file with coordinates for d3ojvd2.
(The format of our PDB-style files is described here.)

Timeline for d3ojvd2: