| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
| Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
| Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries) |
| Domain d3ojtc2: 3ojt C:148-357 [214394] automated match to d1q0oa2 complexed with ca, cl, fe2, p6g, pg4 |
PDB Entry: 3ojt (more details), 1.7 Å
SCOPe Domain Sequences for d3ojtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ojtc2 d.32.1.3 (C:148-357) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqask
Timeline for d3ojtc2: