SCOPe 2.03: Domain d3ojtb2: 3ojt B:148-362

Lineage for d3ojtb2 (3ojt B:148-362)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (14 PDB entries)

8. Domain d3ojtb2: 3ojt B:148-362 [214392]
   automated match to d1q0oa2
   complexed with ca, cl, fe2, p6g, pg4

Details for d3ojtb2

PDB Entry: 3ojt, 1.7 Å

PDB Description: Structure of native Fe-containing Homoprotocatechuate 2,3-Dioxygenase at 1.70 Ang resolution

PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d3ojtb2:

Sequence; same for both SEQRES and ATOM records:

>d3ojtb2 d.32.1.3 (B:148-362) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgfklg

Timeline for d3ojtb2:

• d3ojtb2 is new in SCOPe 2.03-stable
  
• d3ojtb2 appears in SCOPe 2.04
  
• d3ojtb2 appears in the current release, SCOPe 2.08