Lineage for d3ojmb2 (3ojm B:251-361)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765503Domain d3ojmb2: 3ojm B:251-361 [214380]
    Other proteins in same PDB: d3ojma_, d3ojmb1
    automated match to d1ev2g2
    complexed with so4; mutant

Details for d3ojmb2

PDB Entry: 3ojm (more details), 2.1 Å

PDB Description: Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert mutation
PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3ojmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojmb2 b.1.1.0 (B:251-361) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlpkq

SCOPe Domain Coordinates for d3ojmb2:

Click to download the PDB-style file with coordinates for d3ojmb2.
(The format of our PDB-style files is described here.)

Timeline for d3ojmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ojmb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ojma_