Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [49107] (2 PDB entries) |
Domain d1c5cl2: 1c5c L:108-214 [21438] Other proteins in same PDB: d1c5ch1, d1c5cl1 |
PDB Entry: 1c5c (more details), 1.61 Å
SCOP Domain Sequences for d1c5cl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1c5cl2: