Lineage for d3ojmb1 (3ojm B:151-250)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295762Protein automated matches [190803] (1 species)
    not a true protein
  7. 1295763Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries)
  8. 1295779Domain d3ojmb1: 3ojm B:151-250 [214379]
    Other proteins in same PDB: d3ojma_, d3ojmb2
    automated match to d1ev2g1
    complexed with so4; mutant

Details for d3ojmb1

PDB Entry: 3ojm (more details), 2.1 Å

PDB Description: Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert mutation
PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3ojmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojmb1 b.1.1.4 (B:151-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOPe Domain Coordinates for d3ojmb1:

Click to download the PDB-style file with coordinates for d3ojmb1.
(The format of our PDB-style files is described here.)

Timeline for d3ojmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ojmb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ojma_