SCOPe 2.08: Domain d3ojmb1: 3ojm B:151-250

Lineage for d3ojmb1 (3ojm B:151-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d3ojmb1: 3ojm B:151-250 [214379]
   Other proteins in same PDB: d3ojma_, d3ojmb2
   automated match to d1ev2g1
   complexed with so4; mutant

Details for d3ojmb1

PDB Entry: 3ojm, 2.1 Å

PDB Description: Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert mutation

PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3ojmb1:

Sequence; same for both SEQRES and ATOM records:

>d3ojmb1 b.1.1.4 (B:151-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

Timeline for d3ojmb1:

• d3ojmb1 first appeared in SCOPe 2.03
  
• d3ojmb1 appears in SCOPe 2.07