SCOPe 2.04: Domain d1fskk2: 1fsk K:108-214

Lineage for d1fskk2 (1fsk K:108-214)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

Domain d1fskk2: 1fsk K:108-214 [21436]
Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskc2, d1fskd_, d1fske1, d1fskf1, d1fskf2, d1fskg_, d1fskh1, d1fski1, d1fski2, d1fskj_, d1fskk1, d1fskl1, d1fskl2
part of anti-bet v1 Fab BV16

Details for d1fskk2

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

PDB Compounds: (K:) immunoglobulin kappa light chain

SCOPe Domain Sequences for d1fskk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskk2 b.1.1.2 (K:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1fskk2:

Click to download the PDB-style file with coordinates for d1fskk2.
(The format of our PDB-style files is described here.)

Timeline for d1fskk2: