Lineage for d3ojcd2 (3ojc D:118-231)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2907332Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2907351Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 2907352Protein automated matches [226982] (4 species)
    not a true protein
  7. 2907382Species Yersinia pestis [TaxId:214092] [225966] (1 PDB entry)
  8. 2907390Domain d3ojcd2: 3ojc D:118-231 [214359]
    automated match to d1jfla2
    complexed with ca, hez

Details for d3ojcd2

PDB Entry: 3ojc (more details), 1.75 Å

PDB Description: crystal structure of a putative asp/glu racemase from yersinia pestis
PDB Compounds: (D:) Putative aspartate/glutamate racemase

SCOPe Domain Sequences for d3ojcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojcd2 c.78.2.0 (D:118-231) automated matches {Yersinia pestis [TaxId: 214092]}
idkigllgtrytmeqgfyrgrltekhgievitpddtdreavnriiyeelclgiisetsrd
ayrrvikkleaqgvqgiifgcteitllvnaqdasvpvfdttaihasaaadyalq

SCOPe Domain Coordinates for d3ojcd2:

Click to download the PDB-style file with coordinates for d3ojcd2.
(The format of our PDB-style files is described here.)

Timeline for d3ojcd2: