SCOPe 2.03: Domain d3ojcc1: 3ojc C:2-117

Lineage for d3ojcc1 (3ojc C:2-117)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.0: automated matches [227233] (1 protein)
   not a true family

6. Protein automated matches [226982] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [225966] (1 PDB entry)

8. Domain d3ojcc1: 3ojc C:2-117 [214356]
   automated match to d1jfla1
   complexed with ca, hez

Details for d3ojcc1

PDB Entry: 3ojc, 1.75 Å

PDB Description: crystal structure of a putative asp/glu racemase from yersinia pestis

PDB Compounds: (C:) Putative aspartate/glutamate racemase

SCOPe Domain Sequences for d3ojcc1:

Sequence; same for both SEQRES and ATOM records:

>d3ojcc1 c.78.2.0 (C:2-117) automated matches {Yersinia pestis [TaxId: 214092]}
mkilgliggmswestipyyrminqhvkaqlgglhsakiilysvdfheieqlqakgdwqta
aqllsnaaislkhagaevivvctntmhkvaddieaacglpllhiadatavqikqqg

Timeline for d3ojcc1:

• d3ojcc1 is new in SCOPe 2.03-stable
  
• d3ojcc1 appears in SCOPe 2.04
  
• d3ojcc1 appears in the current release, SCOPe 2.08