| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) ![]() |
| Family c.78.2.0: automated matches [227233] (1 protein) not a true family |
| Protein automated matches [226982] (4 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [225966] (1 PDB entry) |
| Domain d3ojcb2: 3ojc B:118-231 [214355] automated match to d1jfla2 complexed with ca, hez |
PDB Entry: 3ojc (more details), 1.75 Å
SCOPe Domain Sequences for d3ojcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ojcb2 c.78.2.0 (B:118-231) automated matches {Yersinia pestis [TaxId: 214092]}
idkigllgtrytmeqgfyrgrltekhgievitpddtdreavnriiyeelclgiisetsrd
ayrrvikkleaqgvqgiifgcteitllvnaqdasvpvfdttaihasaaadyalq
Timeline for d3ojcb2: