Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1fski2: 1fsk I:119-220 [21435] Other proteins in same PDB: d1fska_, d1fskb1, d1fskb2, d1fskc1, d1fskd_, d1fske1, d1fske2, d1fskf1, d1fskg_, d1fskh1, d1fskh2, d1fski1, d1fskj_, d1fskk1, d1fskk2, d1fskl1 |
PDB Entry: 1fsk (more details), 2.9 Å
SCOP Domain Sequences for d1fski2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fski2 b.1.1.2 (I:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d1fski2: