Lineage for d3oj6d_ (3oj6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918813Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2918814Protein automated matches [190746] (16 species)
    not a true protein
  7. 2918832Species Fungus (Coccidioides immitis) [TaxId:5501] [225967] (1 PDB entry)
  8. 2918836Domain d3oj6d_: 3oj6 D: [214349]
    Other proteins in same PDB: d3oj6b2
    automated match to d2z3ia_
    complexed with cl, edo, zn

Details for d3oj6d_

PDB Entry: 3oj6 (more details), 1.7 Å

PDB Description: crystal structure of blasticidin s deaminase from coccidioides immitis
PDB Compounds: (D:) Blasticidin-S deaminase

SCOPe Domain Sequences for d3oj6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oj6d_ c.97.1.0 (D:) automated matches {Fungus (Coccidioides immitis) [TaxId: 5501]}
eplsaagqnlidtatsvingipvsdfysvasaaisddgrvfsgvnvyhfnggpcaelvvl
gvaaaagatklthivaianegrgilspcgrcrqvladlhpgikaivigkegpkmvaveel
lpsiyawdkdydri

SCOPe Domain Coordinates for d3oj6d_:

Click to download the PDB-style file with coordinates for d3oj6d_.
(The format of our PDB-style files is described here.)

Timeline for d3oj6d_: