![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
![]() | Protein automated matches [190746] (16 species) not a true protein |
![]() | Species Fungus (Coccidioides immitis) [TaxId:5501] [225967] (1 PDB entry) |
![]() | Domain d3oj6c_: 3oj6 C: [214348] Other proteins in same PDB: d3oj6b2 automated match to d2z3ia_ complexed with cl, edo, zn |
PDB Entry: 3oj6 (more details), 1.7 Å
SCOPe Domain Sequences for d3oj6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oj6c_ c.97.1.0 (C:) automated matches {Fungus (Coccidioides immitis) [TaxId: 5501]} eplsaagqnlidtatsvingipvsdfysvasaaisddgrvfsgvnvyhfnggpcaelvvl gvaaaagatklthivaianegrgilspcgrcrqvladlhpgikaivigkegpkmvaveel lpsiyawd
Timeline for d3oj6c_:
![]() Domains from other chains: (mouse over for more information) d3oj6a_, d3oj6b1, d3oj6b2, d3oj6d_ |