Lineage for d3oiib_ (3oii B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528643Family c.116.1.6: EMG1/NEP1-like [159513] (3 proteins)
    Pfam PF03587; structurally most similar to the AF1056-like family, but more decorated
  6. 2528656Protein automated matches [227048] (1 species)
    not a true protein
  7. 2528657Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226029] (1 PDB entry)
  8. 2528659Domain d3oiib_: 3oii B: [214345]
    automated match to d2v3ja1
    complexed with gol, sah

Details for d3oiib_

PDB Entry: 3oii (more details), 1.85 Å

PDB Description: crystal structure of saccharomyces cerevisiae nep1/emg1 bound to s- adenosylhomocysteine
PDB Compounds: (B:) essential for mitotic growth 1

SCOPe Domain Sequences for d3oiib_:

Sequence, based on SEQRES records: (download)

>d3oiib_ c.116.1.6 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ppvltskdkitkrmivvlamaslethkissngpggdkyvllncddhqgllkkmgrdisea
rpdithqclltlldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhk
lsirsvnseekllkviknpitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvg
amargkdnfadeyvdekvglsnyplsasvacskfchgaedawnil

Sequence, based on observed residues (ATOM records): (download)

>d3oiib_ c.116.1.6 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ppvltskdkitkrmivvlamaslethvllncddhqgllkkmgrdisearpdithqclltl
ldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhklsirskllkvik
npitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvgamargkdnfadeyvdek
vglsnyplsasvacskfchgaedawnil

SCOPe Domain Coordinates for d3oiib_:

Click to download the PDB-style file with coordinates for d3oiib_.
(The format of our PDB-style files is described here.)

Timeline for d3oiib_: