![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.6: EMG1/NEP1-like [159513] (3 proteins) Pfam PF03587; structurally most similar to the AF1056-like family, but more decorated |
![]() | Protein automated matches [227048] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226029] (1 PDB entry) |
![]() | Domain d3oiia_: 3oii A: [214344] automated match to d2v3ja1 complexed with gol, sah |
PDB Entry: 3oii (more details), 1.85 Å
SCOPe Domain Sequences for d3oiia_:
Sequence, based on SEQRES records: (download)
>d3oiia_ c.116.1.6 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ppvltskdkitkrmivvlamaslethkissngpggdkyvllncddhqgllkkmgrdisea rpdithqclltlldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhk lsirsvnseekllkviknpitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvg amargkdnfadeyvdekvglsnyplsasvacskfchgaedawnil
>d3oiia_ c.116.1.6 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ppvltskdkitkrmivvlamaslethkiyvllncddhqgllkkmgrdisearpdithqcl ltlldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhklsirsvnse ekllkviknpitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvgamargkdnf adeyvdekvglsnyplsasvacskfchgaedawnil
Timeline for d3oiia_: