SCOPe 2.07: Domain d3oidb1: 3oid B:1-250

Lineage for d3oidb1 (3oid B:1-250)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)

8. Domain d3oidb1: 3oid B:1-250 [214341]
   Other proteins in same PDB: d3oida2, d3oidb2, d3oidc2, d3oidd2
   automated match to d3oicd_
   complexed with ndp, tcl

Details for d3oidb1

PDB Entry: 3oid, 1.8 Å

PDB Description: Crystal Structure of Enoyl-ACP Reductases III (FabL) from B. subtilis (complex with NADP and TCL)

PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADPH]

SCOPe Domain Sequences for d3oidb1:

Sequence; same for both SEQRES and ATOM records:

>d3oidb1 c.2.1.0 (B:1-250) automated matches {Bacillus subtilis [TaxId: 1423]}
meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
ivdggrsllv

Timeline for d3oidb1:

• d3oidb1 first appeared in SCOPe 2.03, called d3oidb_
  
• d3oidb1 appears in SCOPe 2.06
  
• d3oidb1 appears in the current release, SCOPe 2.08