Lineage for d1fskh2 (1fsk H:108-214)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454353Domain d1fskh2: 1fsk H:108-214 [21434]
    Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskc2, d1fskd_, d1fske1, d1fskf1, d1fskf2, d1fskg_, d1fskh1, d1fski1, d1fski2, d1fskj_, d1fskk1, d1fskl1, d1fskl2

Details for d1fskh2

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskh2 b.1.1.2 (H:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1fskh2:

Click to download the PDB-style file with coordinates for d1fskh2.
(The format of our PDB-style files is described here.)

Timeline for d1fskh2: