Lineage for d3of8a_ (3of8 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634834Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)
  8. 1634855Domain d3of8a_: 3of8 A: [214334]
    automated match to d3f75a_
    complexed with i0y

Details for d3of8a_

PDB Entry: 3of8 (more details), 2.2 Å

PDB Description: structural basis for reversible and irreversible inhibition of human cathepsin l by their respective dipeptidyl glyoxal and diazomethylketone inhibitors
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d3of8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3of8a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgp
qgnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqe
kalmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdn
nkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d3of8a_:

Click to download the PDB-style file with coordinates for d3of8a_.
(The format of our PDB-style files is described here.)

Timeline for d3of8a_: