SCOPe 2.08: Domain d3of6c1: 3of6 C:1-119

Lineage for d3of6c1 (3of6 C:1-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3of6c1: 3of6 C:1-119 [214332]
   Other proteins in same PDB: d3of6a2, d3of6b2, d3of6c2
   automated match to d1qrne1
   complexed with nag

Details for d3of6c1

PDB Entry: 3of6, 2.8 Å

PDB Description: human pre-t cell receptor crystal structure

PDB Compounds: (C:) T cell receptor beta chain

SCOPe Domain Sequences for d3of6c1:

Sequence; same for both SEQRES and ATOM records:

>d3of6c1 b.1.1.0 (C:1-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksgl
psdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvted

Timeline for d3of6c1:

• d3of6c1 first appeared in SCOPe 2.03
  
• d3of6c1 appears in SCOPe 2.07