SCOPe 2.08: Domain d3of6a2: 3of6 A:120-245

Lineage for d3of6a2 (3of6 A:120-245)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3of6a2: 3of6 A:120-245 [214329]
   Other proteins in same PDB: d3of6a1, d3of6b1, d3of6c1
   automated match to d1qsee2
   complexed with nag

Details for d3of6a2

PDB Entry: 3of6, 2.8 Å

PDB Description: human pre-t cell receptor crystal structure

PDB Compounds: (A:) T cell receptor beta chain

SCOPe Domain Sequences for d3of6a2:

Sequence; same for both SEQRES and ATOM records:

>d3of6a2 b.1.1.2 (A:120-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgr

Timeline for d3of6a2:

• d3of6a2 first appeared in SCOPe 2.03
  
• d3of6a2 appears in SCOPe 2.07