![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1fske2: 1fsk E:108-214 [21432] Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskc2, d1fskd_, d1fske1, d1fskf1, d1fskf2, d1fskg_, d1fskh1, d1fski1, d1fski2, d1fskj_, d1fskk1, d1fskl1, d1fskl2 |
PDB Entry: 1fsk (more details), 2.9 Å
SCOP Domain Sequences for d1fske2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fske2 b.1.1.2 (E:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1fske2: