| Class b: All beta proteins [48724] (177 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
| Protein multi-copper oxidase CueO [69194] (1 species) |
| Species Escherichia coli [TaxId:562] [69195] (34 PDB entries) |
| Domain d3od3a3: 3od3 A:336-516 [214317] automated match to d1n68a3 complexed with cu, edo, o |
PDB Entry: 3od3 (more details), 1.1 Å
SCOPe Domain Sequences for d3od3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3od3a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v
Timeline for d3od3a3: