SCOP 1.73: Domain d1fskc2: 1fsk C:119-220

Lineage for d1fskc2 (1fsk C:119-220)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1fskc2: 1fsk C:119-220 [21431]
   Other proteins in same PDB: d1fska_, d1fskb1, d1fskb2, d1fskc1, d1fskd_, d1fske1, d1fske2, d1fskf1, d1fskg_, d1fskh1, d1fskh2, d1fski1, d1fskj_, d1fskk1, d1fskk2, d1fskl1

Details for d1fskc2

PDB Entry: 1fsk, 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

PDB Compounds: (C:) antibody heavy chain fab

SCOP Domain Sequences for d1fskc2:

Sequence; same for both SEQRES and ATOM records:

>d1fskc2 b.1.1.2 (C:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1fskc2:

• d1fskc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fskc2 appears in SCOP 1.71
  
• d1fskc2 appears in SCOP 1.75
  
• d1fskc2 appears in the current release, SCOPe 2.08