Lineage for d3ocfb1 (3ocf B:2-440)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010428Species Brucella melitensis [TaxId:359391] [225949] (2 PDB entries)
  8. 2010430Domain d3ocfb1: 3ocf B:2-440 [214308]
    Other proteins in same PDB: d3ocfb2, d3ocfd2
    automated match to d3r6vd_
    complexed with cl, edo

Details for d3ocfb1

PDB Entry: 3ocf (more details), 2.1 Å

PDB Description: Crystal structure of fumarate lyase:delta crystallin from Brucella melitensis in native form
PDB Compounds: (B:) Fumarate lyase:Delta crystallin

SCOPe Domain Sequences for d3ocfb1:

Sequence, based on SEQRES records: (download)

>d3ocfb1 a.127.1.0 (B:2-440) automated matches {Brucella melitensis [TaxId: 359391]}
trreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatanyk
lrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgrp
rgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatvi
kigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlggtaigtrinashay
aeqaivelsqisgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgp
rsglgeirlpavqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafe
plivynilssmrllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraa
eiakqalasgqtvmevais

Sequence, based on observed residues (ATOM records): (download)

>d3ocfb1 a.127.1.0 (B:2-440) automated matches {Brucella melitensis [TaxId: 359391]}
trreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatanyk
lrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgrp
rgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatvi
kigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlgghayaeqaivelsq
isgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgprsglgeirlp
avqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafeplivynilss
mrllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraaeiakqalasg
qtvmevais

SCOPe Domain Coordinates for d3ocfb1:

Click to download the PDB-style file with coordinates for d3ocfb1.
(The format of our PDB-style files is described here.)

Timeline for d3ocfb1: