![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Ehrlichia chaffeensis [TaxId:205920] [189753] (2 PDB entries) |
![]() | Domain d3ocab_: 3oca B: [214302] automated match to d3u04a_ complexed with cl, zn |
PDB Entry: 3oca (more details), 2.4 Å
SCOPe Domain Sequences for d3ocab_:
Sequence, based on SEQRES records: (download)
>d3ocab_ d.167.1.0 (B:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} svlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilvm nvpeefedsedienvedkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyi vrpqriavqyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkk kertdli
>d3ocab_ d.167.1.0 (B:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} svlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilvm nvpeefeddkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyivrpqriav qyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkkkertdli
Timeline for d3ocab_: