SCOPe 2.08: Domain d3ocab_: 3oca B:

Lineage for d3ocab_ (3oca B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [189753] (2 PDB entries)

8. Domain d3ocab_: 3oca B: [214302]
   automated match to d3u04a_
   complexed with cl, zn

Details for d3ocab_

PDB Entry: 3oca, 2.4 Å

PDB Description: Crystal structure of peptide deformylase from Ehrlichia chaffeensis

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d3ocab_:

Sequence, based on SEQRES records:

>d3ocab_ d.167.1.0 (B:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
svlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilvm
nvpeefedsedienvedkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyi
vrpqriavqyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkk
kertdli

Sequence, based on observed residues (ATOM records):

>d3ocab_ d.167.1.0 (B:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
svlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilvm
nvpeefeddkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyivrpqriav
qyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkkkertdli

Timeline for d3ocab_:

• d3ocab_ first appeared in SCOPe 2.03
  
• d3ocab_ appears in SCOPe 2.07