Lineage for d3obva_ (3obv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339075Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 proteins)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. 2339076Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 2339077Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 2339080Domain d3obva_: 3obv A: [214295]
    automated match to d2bapa1
    complexed with suc

Details for d3obva_

PDB Entry: 3obv (more details), 2.75 Å

PDB Description: autoinhibited formin mdia1 structure
PDB Compounds: (A:) Protein diaphanous homolog 1

SCOPe Domain Sequences for d3obva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obva_ a.118.1.23 (A:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
qivlhkngtdpdfkcrhlqidi

SCOPe Domain Coordinates for d3obva_:

Click to download the PDB-style file with coordinates for d3obva_.
(The format of our PDB-style files is described here.)

Timeline for d3obva_: