SCOPe 2.08: Domain d3obfb1: 3obf B:129-301

Lineage for d3obfb1 (3obf B:129-301)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Arthrobacter aurescens [TaxId:290340] [225953] (1 PDB entry)

8. Domain d3obfb1: 3obf B:129-301 [214292]
   Other proteins in same PDB: d3obfa2, d3obfb2
   automated match to d2o99d_

Details for d3obfb1

PDB Entry: 3obf, 2.16 Å

PDB Description: Crystal structure of putative transcriptional regulator, IclR family; targeted domain 129...302

PDB Compounds: (B:) Putative transcriptional regulator, IclR family

SCOPe Domain Sequences for d3obfb1:

Sequence; same for both SEQRES and ATOM records:

>d3obfb1 d.110.2.0 (B:129-301) automated matches {Arthrobacter aurescens [TaxId: 290340]}
eerrvaypvlreltertgetsalmvwngnesmcveqipsrhqvkhlaplgarynealsss
vqvflasenedrvrqllrsgsitltgvdedaveayllrlkesmergwavnfgetsieevg
vaspvydhrgnmvasvlipapkfrvsqdtlnslgeacaaaaakvttrlggrap

Timeline for d3obfb1:

• d3obfb1 first appeared in SCOPe 2.03, called d3obfb_
  
• d3obfb1 appears in SCOPe 2.07