SCOP 1.67: Domain d1fh5h2: 1fh5 H:121-215

Lineage for d1fh5h2 (1fh5 H:121-215)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1fh5h2: 1fh5 H:121-215 [21429]
   Other proteins in same PDB: d1fh5h1, d1fh5l1, d1fh5l2
   part of Fab MAK33; conflict: annotated in PDB as human protein

Details for d1fh5h2

PDB Entry: 1fh5, 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33

SCOP Domain Sequences for d1fh5h2:

Sequence; same for both SEQRES and ATOM records:

>d1fh5h2 b.1.1.2 (H:121-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplavtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
tsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1fh5h2:

• d1fh5h2 first appeared (with stable ids) in SCOP 1.55
  
• d1fh5h2 appears in SCOP 1.65
  
• d1fh5h2 appears in SCOP 1.69
  
• d1fh5h2 appears in the current release, SCOPe 2.08