Lineage for d3ob7b_ (3ob7 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578916Species Human (Homo sapiens) [TaxId:9606] [55840] (42 PDB entries)
  8. 2579030Domain d3ob7b_: 3ob7 B: [214287]
    automated match to d2aaza_
    complexed with gsh, po4

Details for d3ob7b_

PDB Entry: 3ob7 (more details), 2.75 Å

PDB Description: human thymidylate synthase r163k with cys 195 covalently modified by glutathione
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d3ob7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ob7b_ d.117.1.1 (B:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d3ob7b_:

Click to download the PDB-style file with coordinates for d3ob7b_.
(The format of our PDB-style files is described here.)

Timeline for d3ob7b_: