Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189245] (13 PDB entries) |
Domain d3ob7b_: 3ob7 B: [214287] automated match to d2aaza_ complexed with gsh, po4 |
PDB Entry: 3ob7 (more details), 2.75 Å
SCOPe Domain Sequences for d3ob7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ob7b_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt
Timeline for d3ob7b_:
View in 3D Domains from other chains: (mouse over for more information) d3ob7a_, d3ob7c_, d3ob7d_, d3ob7e_ |