SCOP 1.67: Domain d1fh5l2: 1fh5 L:109-214

Lineage for d1fh5l2 (1fh5 L:109-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1fh5l2: 1fh5 L:109-214 [21428]
   Other proteins in same PDB: d1fh5h1, d1fh5h2, d1fh5l1
   part of Fab MAK33; conflict: annotated in PDB as human protein

Details for d1fh5l2

PDB Entry: 1fh5, 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33

SCOP Domain Sequences for d1fh5l2:

Sequence; same for both SEQRES and ATOM records:

>d1fh5l2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1fh5l2:

• d1fh5l2 first appeared (with stable ids) in SCOP 1.55
  
• d1fh5l2 appears in SCOP 1.65
  
• d1fh5l2 appears in SCOP 1.69
  
• d1fh5l2 appears in the current release, SCOPe 2.08