SCOPe 2.08: Domain d3oayk2: 3oay K:108-213

Lineage for d3oayk2 (3oay K:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3oayk2: 3oay K:108-213 [214275]
   Other proteins in same PDB: d3oayk1, d3oayl1
   automated match to d3fcta2
   complexed with bdf, mli

Details for d3oayk2

PDB Entry: 3oay, 1.95 Å

PDB Description: a non-self sugar mimic of the hiv glycan shield shows enhanced antigenicity

PDB Compounds: (K:) FAB 2G12, light chain

SCOPe Domain Sequences for d3oayk2:

Sequence; same for both SEQRES and ATOM records:

>d3oayk2 b.1.1.2 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3oayk2:

• d3oayk2 first appeared in SCOPe 2.03
  
• d3oayk2 appears in SCOPe 2.07