Lineage for d1f3dk2 (1f3d K:122-221)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221146Species Catalytic Fab 4B2, (mouse), kappa L chain [49104] (1 PDB entry)
  8. 221149Domain d1f3dk2: 1f3d K:122-221 [21427]
    Other proteins in same PDB: d1f3dh1, d1f3dj1, d1f3dk1, d1f3dl1
    complexed with so4, tpm

Details for d1f3dk2

PDB Entry: 1f3d (more details), 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3dk2 b.1.1.2 (K:122-221) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 4B2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1f3dk2:

Click to download the PDB-style file with coordinates for d1f3dk2.
(The format of our PDB-style files is described here.)

Timeline for d1f3dk2: