SCOP 1.61: Domain d1f3dk2: 1f3d K:122-221

Lineage for d1f3dk2 (1f3d K:122-221)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Catalytic Fab 4B2, (mouse), kappa L chain [49104] (1 PDB entry)

8. Domain d1f3dk2: 1f3d K:122-221 [21427]
   Other proteins in same PDB: d1f3dh1, d1f3dj1, d1f3dk1, d1f3dl1

Details for d1f3dk2

PDB Entry: 1f3d, 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dk2:

Sequence; same for both SEQRES and ATOM records:

>d1f3dk2 b.1.1.2 (K:122-221) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 4B2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1f3dk2:

• d1f3dk2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3dk2 appears in SCOP 1.59
  
• d1f3dk2 appears in SCOP 1.63
  
• d1f3dk2 appears in the current release, SCOPe 2.08