SCOPe 2.03: Domain d3o9vc1: 3o9v C:40-508

Lineage for d3o9vc1 (3o9v C:40-508)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225823] (13 PDB entries)

8. Domain d3o9vc1: 3o9v C:40-508 [214263]
   Other proteins in same PDB: d3o9va2, d3o9vb2, d3o9vc2, d3o9vd2
   automated match to d1orva1
   complexed with 10t, nag

Details for d3o9vc1

PDB Entry: 3o9v, 2.75 Å

PDB Description: crystal structure of human dpp4 bound to tak-986

PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3o9vc1:

Sequence; same for both SEQRES and ATOM records:

>d3o9vc1 b.70.3.1 (C:40-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d3o9vc1:

• d3o9vc1 is new in SCOPe 2.03-stable
  
• d3o9vc1 appears in SCOPe 2.04
  
• d3o9vc1 appears in the current release, SCOPe 2.08