Lineage for d3o95d2 (3o95 D:509-766)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1384148Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1384149Protein automated matches [190543] (40 species)
    not a true protein
  7. 1384202Species Human (Homo sapiens) [TaxId:9606] [188340] (20 PDB entries)
  8. 1384242Domain d3o95d2: 3o95 D:509-766 [214249]
    Other proteins in same PDB: d3o95a1, d3o95b1, d3o95c1, d3o95d1
    automated match to d1orva2
    complexed with 01t, nag

Details for d3o95d2

PDB Entry: 3o95 (more details), 2.85 Å

PDB Description: crystal structure of human dpp4 bound to tak-100
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3o95d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o95d2 c.69.1.0 (D:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3o95d2:

Click to download the PDB-style file with coordinates for d3o95d2.
(The format of our PDB-style files is described here.)

Timeline for d3o95d2: