Lineage for d3o95b1 (3o95 B:34-508)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327543Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1327637Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 1327638Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 1327841Protein automated matches [226889] (2 species)
    not a true protein
  7. 1327842Species Human (Homo sapiens) [TaxId:9606] [225823] (13 PDB entries)
  8. 1327873Domain d3o95b1: 3o95 B:34-508 [214244]
    Other proteins in same PDB: d3o95a2, d3o95b2, d3o95c2, d3o95d2
    automated match to d1orva1
    complexed with 01t, nag

Details for d3o95b1

PDB Entry: 3o95 (more details), 2.85 Å

PDB Description: crystal structure of human dpp4 bound to tak-100
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3o95b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o95b1 b.70.3.1 (B:34-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d3o95b1:

Click to download the PDB-style file with coordinates for d3o95b1.
(The format of our PDB-style files is described here.)

Timeline for d3o95b1: