SCOPe 2.05: Domain d3o8ma1: 3o8m A:14-223

Lineage for d3o8ma1 (3o8m A:14-223)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [225987] (8 PDB entries)

8. Domain d3o8ma1: 3o8m A:14-223 [214240]
   automated match to d1ig8a1
   complexed with bgc, cl, glc

Details for d3o8ma1

PDB Entry: 3o8m, 1.42 Å

PDB Description: crystal structure of monomeric klhxk1 in crystal form xi with glucose bound (closed state)

PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d3o8ma1:

Sequence; same for both SEQRES and ATOM records:

>d3o8ma1 c.55.1.0 (A:14-223) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
gsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwvvey
ptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfiakc
lkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpmlqe
qieklnipinvvalindttgtlvaslytdp

Timeline for d3o8ma1:

• d3o8ma1 first appeared in SCOPe 2.03
  
• d3o8ma1 appears in SCOPe 2.04
  
• d3o8ma1 appears in SCOPe 2.06
  
• d3o8ma1 appears in the current release, SCOPe 2.08