Lineage for d1f11d2 (1f11 D:114-227)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453655Domain d1f11d2: 1f11 D:114-227 [21423]
    Other proteins in same PDB: d1f11a1, d1f11a2, d1f11b1, d1f11c1, d1f11c2, d1f11d1
    part of anti-Pres2 Fab F124

Details for d1f11d2

PDB Entry: 1f11 (more details), 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f11d2 b.1.1.2 (D:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1f11d2:

Click to download the PDB-style file with coordinates for d1f11d2.
(The format of our PDB-style files is described here.)

Timeline for d1f11d2: