SCOP 1.63: Domain d1f11d2: 1f11 D:114-227

Lineage for d1f11d2 (1f11 D:114-227)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-Pres2 Fab F124, (mouse), kappa L chain [49103] (1 PDB entry)

8. Domain d1f11d2: 1f11 D:114-227 [21423]
   Other proteins in same PDB: d1f11a1, d1f11b1, d1f11c1, d1f11d1

Details for d1f11d2

PDB Entry: 1f11, 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11d2:

Sequence; same for both SEQRES and ATOM records:

>d1f11d2 b.1.1.2 (D:114-227) Immunoglobulin (constant domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1f11d2:

• d1f11d2 first appeared (with stable ids) in SCOP 1.55
  
• d1f11d2 appears in SCOP 1.61
  
• d1f11d2 appears in SCOP 1.65
  
• d1f11d2 appears in the current release, SCOPe 2.08