Lineage for d3o8ec_ (3o8e C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776959Protein automated matches [190333] (6 species)
    not a true protein
  7. 2777003Species Human adenovirus 11 [TaxId:10541] [225988] (1 PDB entry)
  8. 2777005Domain d3o8ec_: 3o8e C: [214229]
    automated match to d3f0ya_
    complexed with dtd

Details for d3o8ec_

PDB Entry: 3o8e (more details), 2.84 Å

PDB Description: structure of extracelllar portion of cd46 in complex with adenovirus type 11 knob
PDB Compounds: (C:) Fiber 36.1 kDa protein

SCOPe Domain Sequences for d3o8ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8ec_ b.21.1.1 (C:) automated matches {Human adenovirus 11 [TaxId: 10541]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd

SCOPe Domain Coordinates for d3o8ec_:

Click to download the PDB-style file with coordinates for d3o8ec_.
(The format of our PDB-style files is described here.)

Timeline for d3o8ec_: