SCOPe 2.07: Domain d3o8ea_: 3o8e A:

Lineage for d3o8ea_ (3o8e A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein automated matches [190333] (6 species)
   not a true protein

7. Species Human adenovirus 11 [TaxId:10541] [225988] (1 PDB entry)

8. Domain d3o8ea_: 3o8e A: [214228]
   automated match to d3f0ya_
   complexed with dtd, nag

Details for d3o8ea_

PDB Entry: 3o8e, 2.84 Å

PDB Description: structure of extracelllar portion of cd46 in complex with adenovirus type 11 knob

PDB Compounds: (A:) Fiber 36.1 kDa protein

SCOPe Domain Sequences for d3o8ea_:

Sequence; same for both SEQRES and ATOM records:

>d3o8ea_ b.21.1.1 (A:) automated matches {Human adenovirus 11 [TaxId: 10541]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd

Timeline for d3o8ea_:

• d3o8ea_ first appeared in SCOPe 2.03
  
• d3o8ea_ appears in SCOPe 2.06
  
• d3o8ea_ appears in the current release, SCOPe 2.08