![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Kluyveromyces lactis [TaxId:28985] [225987] (8 PDB entries) |
![]() | Domain d3o80a1: 3o80 A:17-223 [214224] automated match to d1ig8a1 complexed with anp |
PDB Entry: 3o80 (more details), 2.18 Å
SCOPe Domain Sequences for d3o80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o80a1 c.55.1.0 (A:17-223) automated matches {Kluyveromyces lactis [TaxId: 28985]} advpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwvveyptg ketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfiakclke fvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpmlqeqie klnipinvvalindttgtlvaslytdp
Timeline for d3o80a1: