SCOPe 2.07: Domain d3o76b2: 3o76 B:79-209

Lineage for d3o76b2 (3o76 B:79-209)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)

8. Domain d3o76b2: 3o76 B:79-209 [214223]
   Other proteins in same PDB: d3o76a1, d3o76b1
   automated match to d1gssa1
   complexed with gtb; mutant

Details for d3o76b2

PDB Entry: 3o76, 1.77 Å

PDB Description: 1.8 Angstroms molecular structure of mouse liver glutathione S-transferase mutant C47A complexed with S-(P-nitrobenzyl)glutathione

PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d3o76b2:

Sequence; same for both SEQRES and ATOM records:

>d3o76b2 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d3o76b2:

• d3o76b2 first appeared in SCOPe 2.03
  
• d3o76b2 appears in SCOPe 2.06