SCOPe 2.05: Domain d3o6jb_: 3o6j B:

Lineage for d3o6jb_ (3o6j B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
   similar overall structure to Catechol 1,2-dioxygenase

7. Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries)
   Uniprot O67987

8. Domain d3o6jb_: 3o6j B: [214213]
   automated match to d1s9aa_
   complexed with cl, fe, hqn, myy

Details for d3o6jb_

PDB Entry: 3o6j, 2.9 Å

PDB Description: crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol

PDB Compounds: (B:) Chlorocatechol 1,2-dioxygenase

SCOPe Domain Sequences for d3o6jb_:

Sequence; same for both SEQRES and ATOM records:

>d3o6jb_ b.3.6.1 (B:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

Timeline for d3o6jb_:

• d3o6jb_ first appeared in SCOPe 2.03
  
• d3o6jb_ appears in SCOPe 2.04
  
• d3o6jb_ appears in SCOPe 2.06
  
• d3o6jb_ appears in the current release, SCOPe 2.08