| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species) similar overall structure to Catechol 1,2-dioxygenase |
| Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries) Uniprot O67987 |
| Domain d3o6ja_: 3o6j A: [214212] automated match to d1s9aa_ complexed with cl, fe, hqn, myy |
PDB Entry: 3o6j (more details), 2.9 Å
SCOPe Domain Sequences for d3o6ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6ja_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn
Timeline for d3o6ja_: