Lineage for d1f11b2 (1f11 B:114-227)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549443Domain d1f11b2: 1f11 B:114-227 [21421]
    Other proteins in same PDB: d1f11a1, d1f11a2, d1f11b1, d1f11c1, d1f11c2, d1f11d1

Details for d1f11b2

PDB Entry: 1f11 (more details), 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f11b2 b.1.1.2 (B:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1f11b2:

Click to download the PDB-style file with coordinates for d1f11b2.
(The format of our PDB-style files is described here.)

Timeline for d1f11b2: