Lineage for d3o6fg2 (3o6f G:111-196)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517839Domain d3o6fg2: 3o6f G:111-196 [214209]
    Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc1, d3o6fd1, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fh1, d3o6fh2
    automated match to d1nfda2

Details for d3o6fg2

PDB Entry: 3o6f (more details), 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4
PDB Compounds: (G:) T-cell receptor alpha chain c region

SCOPe Domain Sequences for d3o6fg2:

Sequence, based on SEQRES records: (download)

>d3o6fg2 b.1.1.2 (G:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d3o6fg2 b.1.1.2 (G:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdkvclftdfdsqtnvsqdvyitdktvldmrsmdfksnsavaws
nksdfacannsiipedtf

SCOPe Domain Coordinates for d3o6fg2:

Click to download the PDB-style file with coordinates for d3o6fg2.
(The format of our PDB-style files is described here.)

Timeline for d3o6fg2: