Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d3o6fg2: 3o6f G:111-196 [214209] Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc1, d3o6fd1, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fh1, d3o6fh2 automated match to d1nfda2 |
PDB Entry: 3o6f (more details), 2.8 Å
SCOPe Domain Sequences for d3o6fg2:
Sequence, based on SEQRES records: (download)
>d3o6fg2 b.1.1.2 (G:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtf
>d3o6fg2 b.1.1.2 (G:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdkvclftdfdsqtnvsqdvyitdktvldmrsmdfksnsavaws nksdfacannsiipedtf
Timeline for d3o6fg2: